PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_025330-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family ZF-HD
Protein Properties Length: 89aa    MW: 9817.95 Da    PI: 8.3821
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_025330-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer103.81.1e-321976260
    ZF-HD_dimer  2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                   ++vrY eC+kNhAa++Gg+avDGC+Efmp+ geegt+aalkCaAC+CHRnFH+reve e
  NNU_025330-RA 19 RTVRYGECRKNHAAHIGGYAVDGCREFMPA-GEEGTSAALKCAACNCHRNFHKREVEIE 76
                   689**************************9.999*********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-221983IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.3E-302173IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.3E-262273IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.5732372IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 89 aa     Download sequence    Send to blast
MGTQEGSKTV SNSPARKERT VRYGECRKNH AAHIGGYAVD GCREFMPAGE EGTSAALKCA  60
ACNCHRNFHK REVEIESFRD CSSNSMAYK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010246148.13e-61PREDICTED: mini zinc finger protein 2-like
SwissprotQ9LJW53e-30MIF2_ARATH; Mini zinc finger protein 2
TrEMBLA5ANG81e-32A5ANG8_VITVI; Putative uncharacterized protein
STRINGVIT_08s0056g01130.t014e-32(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.12e-31mini zinc finger 2